PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00061.73
Common NameAMTR_s00061p00096800, LOC18447438
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family G2-like
Protein Properties Length: 330aa    MW: 36664.1 Da    PI: 6.7006
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00061.73genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.95.6e-344094155
                                  G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                                             kprlrWt eLHerFv+av qLGG+ekAtPkti+++m+vkgLtl+h+kSHLQkYRl
  evm_27.model.AmTr_v1.0_scaffold00061.73 40 KPRLRWTAELHERFVDAVIQLGGPEKATPKTIMRTMNVKGLTLYHLKSHLQKYRL 94
                                             79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.6E-323795IPR009057Homeodomain-like
PROSITE profilePS5129411.8853797IPR017930Myb domain
SuperFamilySSF466896.09E-173996IPR009057Homeodomain-like
TIGRFAMsTIGR015577.7E-244095IPR006447Myb domain, plants
PfamPF002492.9E-84293IPR001005SANT/Myb domain
PfamPF143793.3E-25136181IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MYPGLNHHHE QVLSNEETHG SVEAPGLAID ACLVLTTDPK PRLRWTAELH ERFVDAVIQL  60
GGPEKATPKT IMRTMNVKGL TLYHLKSHLQ KYRLGKQSSK EFSNENRDAS SLSEDQATSS  120
PPSSRVMTRD MNEGYQVTEA LRVQMEVQRR LHEQMEVQRH LQLRIDAQSK YLQSMLERAC  180
KYMTDQAMTS GSNLSVEPQN NHLSFSLLSQ STPDDISETA GVQNNLEDPR AQIGDCSVDS  240
CLTSQSEYSN GGKKRSRPPC FEANSTNWGE DIVGLNMVGQ VKMVRNEGID SCASNVGLHS  300
PRLEHSGLRR PSVFLDAGPV HAKGGIYYL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006857597.10.0PREDICTED: myb family transcription factor APL
SwissprotQ9SAK57e-65APL_ARATH; Myb family transcription factor APL
TrEMBLU5D9B40.0U5D9B4_AMBTC; Uncharacterized protein
STRINGVIT_05s0029g00060.t012e-88(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP7817262
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24120.17e-84G2-like family protein
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]